DPCstruct | MC9781
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 118 ± 14 aa |
| Standard deviation of domain lengths | 13.56 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 51.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0065 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K2DU23 | 128-246 | ELVFMEVVDYNIGSSNIAFIYLEELLIQFREISKLGDLLNMDVCMEILDVLYETEDTSWLFNSPCPLAASTLVTAYVMSVPKQTWEF… |
| A0A0R0EG52 | 1-115 | MGVLNFEIGTTNIAFLFLEDLWIQFKKVAKVGELISIETCMEIMDLLYEKDEMSFLFRSPHSLSASILVASYVMAVPKQKWGFPVLA… |
| A0A7I4A0C5 | 78-210 | None |
| A0A0B2PTD1 | 36-130 | None |
| A0A0E0NS61 | 359-483 | None |
| A0A022RKK6 | 36-155 | None |
| A0A803MXE9 | 70-186 | None |
| A0A0J8BHM5 | 117-258 | None |
| A0A6J1DTP7 | 115-230 | None |
| A0A1R3GRZ1 | 2-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.