DPCstruct | MC9780
Metacluster Properties and Pfam Annotations
| Number of structural domains | 114 |
|---|---|
| Mean domain length (aa) | 134 ± 16 aa |
| Standard deviation of domain lengths | 15.76 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 78.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.75 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 22.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20410 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A154TH52 | 3-111 | QFAQNIYHQGRQIFTEFCQMKNIPYDEKNLDNIAMSMAAVGYANHMRGVSMINIKDDGQILIGHKAIELRKAAVDMAEAISTPIEES… |
| A0A2R7IZ38 | 32-170 | HPEDGRRAGVAAEPAARGPGINDPGHTDYRLFNGAQTGVHALDAAHNRVPNLQSDQLAGALAVQAKREGLESISHVVLSDDHSRAFA… |
| W4SB66 | 11-141 | None |
| A0A7Y5D811 | 734-849 | None |
| A0A7Y5D624 | 130-281 | None |
| A0A7Y4Y4H4 | 575-710 | None |
| A0A4Q3QMR7 | 156-311 | None |
| A0A7Y4Y320 | 228-360 | None |
| A0A6V7F860 | 65-207 | None |
| A0A344J8J8 | 246-356 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.