DPCstruct | MC978
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 57 ± 5 aa |
| Standard deviation of domain lengths | 5.04 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 77.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 47.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N1SVJ6 | 1-54 | MSCPTGKIRYRDRLAAAIALASTSRSTASRREEARTYRCRQCRGWHLTSKPAEE |
| A0A4Q7RFQ4 | 1-61 | MGGGRVSRCKSGKTRYRDEIGAKLALARIQHKDSSGRAKQERRVYLCPLCRGWHLTSKKAR |
| A0A3S4VB44 | 23-87 | None |
| A0A6I5D1U1 | 7-60 | None |
| A0A1C4TP67 | 1-49 | None |
| A0A7X6M2U1 | 47-100 | None |
| G0PS14 | 133-183 | None |
| A0A086ZQ90 | 14-71 | None |
| A0A6G3C401 | 1-61 | None |
| A0A6I5NDT6 | 32-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.