DPCstruct | MC9779
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 429 ± 22 aa |
| Standard deviation of domain lengths | 22.14 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 86.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 19.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07929 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6M8B550 | 139-548 | AVQEQGVTLSAKAIALLQDLRITPTTPGTIVQDFDRLLERIGADGIPLSSTRQQLNLNTLKDLNALLSQPIQIDLKRPQQKSYPNLY… |
| B8HM70 | 209-639 | VTLQDDAEEDGDDFLQQLQANMLQLAIQQHGLELSESAMNLLQQQTITETEPGTIVKDFQTLLEAMGDRGLPVSGKMHHLALKLLPD… |
| A0A1Y4URE4 | 108-514 | None |
| A0A5C8K652 | 2-429 | None |
| A0A2T5C471 | 200-668 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.