DPCstruct | MC9778
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 98 ± 5 aa |
| Standard deviation of domain lengths | 5.37 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 86.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 45.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J3D536 | 390-485 | LTFATALDEYFELGEALDKRDKDAVRKTVSGLIKLIHPDGNYTKEDLEEYLSFALELRRRVKEQLKKIKSIEFWNTDFSYIDRETSK… |
| A0A843CQK6 | 143-239 | KLQFSDVIDRYFVLDESLKERDVKAIRKVVSAMMKLVYPDGKADKDGVREILEFAMEMRSRVKEQLKRIQPDGEFEGVRFAYKDMQL… |
| A0A822IWU5 | 394-492 | None |
| A0A3A9BQJ3 | 879-974 | None |
| E4THI1 | 439-534 | None |
| A0A6B7HJ25 | 27-123 | None |
| A0A0F9CW79 | 2-96 | None |
| A0A1M6KYR1 | 1-114 | None |
| A0A7X7WAP8 | 66-160 | None |
| A0A1M6KFJ6 | 1-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.