DPCstruct | MC9776
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 139 ± 8 aa |
| Standard deviation of domain lengths | 7.63 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 80.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 33.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A501XB98 | 156-290 | FDQFDSSIANTTNEIYANSLKLGTFYKPQSNKIIDFTVQKYDKTIDKVYLLTEAGFIISFTINHREGEEPFIQNYGYIHVFKNVAAD… |
| A0A3B0Q4V4 | 4-139 | ESEQFIKQVEEANRDSQKSSVLVGSFIKLKTNLINQYVIYQTSKNETYLYLLTSSNNIFKITIDKTNSKTKVELDQYTYAYETFLAK… |
| E4PSN5 | 23-159 | None |
| A0A7U3ZSD5 | 138-276 | None |
| A0A502M2S7 | 7-128 | None |
| N9V1P3 | 157-305 | None |
| A0A0F5H293 | 115-265 | None |
| A0A1D5B5K6 | 149-287 | None |
| A0A3B0PDJ2 | 1-141 | None |
| A0A3G8LGP5 | 184-326 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.