DPCstruct | MC9775
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 115 ± 10 aa |
| Standard deviation of domain lengths | 9.52 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 76.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 37.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H6KCQ2 | 3-119 | QRRYLGQAPSGRQLNSIEASWTEAKKLFYKPALGYTEFAKRVEALRMLAFWALVTGLTLDIALNPPKSQYWAKWNLIKMPSRIMEKF… |
| A0A813G294 | 20-138 | AMRMARRNLGDSVVGPPLTDIPSNAKIAMTFFTKSPMSYGEYKQQCVSLRLFAFIGVTAGCVLSLMINPPKSSYWMRYSPMYGLSYV… |
| A0A1Q9DNR2 | 182-306 | None |
| B6ABJ3 | 36-140 | None |
| A0A1J1H1T3 | 1-126 | None |
| U6LYM0 | 24-143 | None |
| A0A7S2NCA0 | 58-156 | None |
| W7FIQ6 | 64-185 | None |
| A0A813AVR9 | 15-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.