DPCstruct | MC9774
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 227 ± 36 aa |
| Standard deviation of domain lengths | 36.02 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 73.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 27.56 |
| Pfam Score | 97.56 |
| Assigned Pfam label(s) | PF05454- PF15445- CL0656 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W4J7I5 | 2-170 | WKTTEIAAAMELAKQAGAAKGAAAGLKAGVDAVITGLKELGVKDFCPDLLQSIGSKIHYTNAEQIANSILRKFNATCYLSNDITTDG… |
| A0A024WW07 | 234-461 | DIHSDAIPTCICEKSMADKVEKGCLRCGSILGAAMPEVGSIGGGLLYALNAWKPAALLAATEYALAEGAAKGLAAGNVKGVEIVLLG… |
| A0A2P9A805 | 80-326 | None |
| A0A024UY72 | 23-261 | None |
| A0A0L1I650 | 66-335 | None |
| A0A0L1I5Q9 | 51-288 | None |
| W7F8B6 | 1-227 | None |
| W7FQN3 | 1-190 | None |
| A0A024VW66 | 2-166 | None |
| A0A024VK06 | 51-304 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.