DPCstruct | MC9773
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 214 ± 17 aa |
| Standard deviation of domain lengths | 16.92 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 68.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 43.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF15863 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A9M6V1 | 516-714 | GSVPAGARACAAAGAANPAKCIDEGTTRSTTVHVGPNHQVPALPAFFLDSSCWPRPPADTVLDPSLTARLVYSPSALERIKLRREQE… |
| A0A024WV22 | 1-212 | MDKLLQPKKGKKKRVTEEGSKESGKINVGDSYQVSNLPNFFLCRSELMYKNYDTQENTNDQMCLSCSGLPCHCKVGEATLVYSPIML… |
| F0V9T7 | 390-594 | None |
| A0A2C6L9T9 | 297-538 | None |
| A0A1D3U8J6 | 913-1137 | None |
| A0A1J1GKP3 | 859-1085 | None |
| Q4UF96 | 135-338 | None |
| U6JR95 | 245-460 | None |
| A0A1J1HAK3 | 736-958 | None |
| A0A1D3D238 | 92-338 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.