DPCstruct | MC9772
Metacluster Properties and Pfam Annotations
| Number of structural domains | 97 |
|---|---|
| Mean domain length (aa) | 65 ± 4 aa |
| Standard deviation of domain lengths | 4.37 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 36.60 |
| Pfam Score | 99.23 |
| Assigned Pfam label(s) | PF03453- CL0303 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A167RLJ2 | 2-62 | IYFLNNNIENKKKVSVALAEIFGLGKRGCTDICDLVGISENIRICHLSGRQLDLLGAVIEE |
| A0A024WQ05 | 1-66 | MSLQVIDNNDFQHILRILNTNVDGKEKVIIALTAIKGIGKRMATVICKQANVDPTKRAGELTTEEI |
| I6N5P4 | 2-64 | None |
| A0A6B9VAZ8 | 48-110 | None |
| A0A6P5MYG1 | 28-92 | None |
| A0A0V1BQL9 | 147-210 | None |
| A0A6M3X264 | 1-66 | None |
| Q6CFI9 | 3-68 | None |
| A0A7R9AN67 | 86-155 | None |
| A0A5J4P3P1 | 1-65 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.