DPCstruct | MC9771
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 97 ± 8 aa |
| Standard deviation of domain lengths | 7.65 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 41.29 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0E0M114 | 21-115 | VECDAPIDKRLTEASKAINEALDAVVAAAPPGKKAELVDATWKQRMFALGALGVAEGDEKKVATTTLAYKKAASAVLAAAPAEKFKV… |
| Q7XYF3 | 11-114 | ATMVTAALVPIECATVIDKELERKAKEALDAVIASAPPEKKSETTDAAVNLMAMSFICIGWAKKAGNEEEVVARINDFKKAADQVLA… |
| A0A811QQQ7 | 7-95 | None |
| Q9LI33 | 43-157 | None |
| A0A0E0QR84 | 10-97 | None |
| A0A835EQU3 | 61-151 | None |
| A3ARG7 | 15-110 | None |
| A0A804NYN1 | 17-115 | None |
| A0A0E0IKP6 | 43-136 | None |
| A0A811PW61 | 29-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.