DPCstruct | MC9770
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 211 ± 17 aa |
| Standard deviation of domain lengths | 17.17 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 80.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 17.70 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0181 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K1LBE7 | 1-202 | MRALLVKDWIVSRKLLILSLIILILVSFVVSNDQLPLILGLLLSMFNMRNIDGLEDKNEYHALVQSMPVSRFEVVVSKTIFHFLQVG… |
| A0A4U2ZDT6 | 2-218 | KGLIYTNFSLIRKVILVYMLIGIGIAVVMLNVIGSEALSLSMVMVCIVIITPVWEAIKVEALSGYNKYVLTLPVTRRTVIQSYYVFF… |
| A0A412L946 | 2-218 | None |
| A0A4Q2A4X8 | 27-257 | None |
| A0A1C5P1I2 | 1-230 | None |
| A0A4Q5EMG2 | 619-803 | None |
| R5ECT4 | 1-243 | None |
| A0A5K1JDU1 | 2-190 | None |
| A8MMA1 | 2-202 | None |
| A0A3A6G468 | 2-212 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.