DPCstruct | MC977
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 263 ± 41 aa |
| Standard deviation of domain lengths | 40.80 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 75.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 21.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13094 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N6TLZ1 | 6-250 | KHSNEEHDQDNARTKRYAYLKPHVRRVSERTIKTKWSTLPEATQDKVRDMFRALERPVIVRQQNERKRIEAQAAVQTVVKNLGKRLP… |
| A0A0W4ZQF4 | 46-288 | RQPLEKFHQEHTIPYLRQQIRRIPRSVINKRWTRISESSLIQIVEILKDIQRSVIMSIRHKTRRMDAQRNLNIMINKIRDRLSRLLV… |
| C4JXM6 | 1-259 | None |
| A0A6G1FS09 | 56-321 | None |
| A0A1Y2FKX1 | 25-377 | None |
| A0A6J3JMD7 | 1-234 | None |
| R1EB78 | 140-423 | None |
| A0A5N5Q3R0 | 4-246 | None |
| A0A5N5PTR9 | 275-568 | None |
| A0A0D2EQN3 | 1-294 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.