DPCstruct | MC9768
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 95 ± 12 aa |
| Standard deviation of domain lengths | 11.54 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 51.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08656 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1UUC1 | 2-91 | SKNPYANNSQLSSLEQEVLWEYVKLSDKIKRISNLAKETAETPNESLLTELRDLEKKMGLVLTLFKASVWTVVNDREAELAAKVAQE… |
| A0A316VK91 | 1-88 | MNENPYSGHRLLSEKEQEVLGEYARLAGTIRRIVDLSNSLSSSEKHEHLLRDLRILERKMGLVLTLFKASVWSLIQTHQDELEEEQHQ |
| A0A0D0BHB8 | 11-82 | None |
| A0A1B9HDS2 | 1-104 | None |
| I2FXB4 | 17-113 | None |
| A0A0C9VYT5 | 11-109 | None |
| A0A0D0YF04 | 1-100 | None |
| A0A550C390 | 24-103 | None |
| A0A165HXZ6 | 9-118 | None |
| A0A165DC34 | 92-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.