DPCstruct | MC9765
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 193 ± 27 aa |
| Standard deviation of domain lengths | 27.17 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10153 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A058ZHJ4 | 19-193 | LGKSRLKGILRGAERLLKKEGLDAETRAAMEARAQAVRDRLAALEAQELEAASVAPEAVVAAPAPSFRKRELTQIESVQLQRYNMVR… |
| A0A1Y1UGQ4 | 18-240 | PSRPRPKPLEQRDGSGVPGLSKLKASIRQTKRLLAKDTLEPGFKIATQRRLASLQADLAKAELREVEKKNGGKYHMVKFFERQKATR… |
| R4XPI7 | 4-156 | None |
| A0A6T6RZJ5 | 49-216 | None |
| D8QXP4 | 12-229 | None |
| Q09867 | 1-170 | None |
| A0A507QX23 | 106-276 | None |
| A0A197K246 | 44-219 | None |
| A0A161HX28 | 5-164 | None |
| F0VDV1 | 3-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.