DPCstruct | MC9764
Metacluster Properties and Pfam Annotations
| Number of structural domains | 113 |
|---|---|
| Mean domain length (aa) | 180 ± 36 aa |
| Standard deviation of domain lengths | 36.15 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 75.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 15.64 |
| Pfam Score | 70.93 |
| Assigned Pfam label(s) | PF14941- PF08999- PF04089 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q0E1K5 | 3-144 | ADSDADSISLELRKPDGTLVSFTADFRKDVKIFRALILGELEKGQSQFQALCFVTRLHHNEIIPSEAMAKLRQKNPRAVRQAEEVRG… |
| A0A023VYT8 | 25-191 | QLQKCNAQHTSIEPLMREEEERFPTKVYHIVDDDETEQDIEVDQARDREIIHLKERDSDEYSLPVFDFKQNLGAIYDDLTGSCYVMG… |
| A0A1S3LZG1 | 31-225 | None |
| A0A3S1B9H2 | 65-259 | None |
| A0A4U5LPV1 | 287-549 | None |
| A0A3Q3G3Z2 | 49-184 | None |
| A0A7M5WJZ8 | 14-151 | None |
| A0A2B4S3U8 | 22-201 | None |
| A0A2B4S2Y8 | 162-344 | None |
| A0A368G4C3 | 2-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.