DPCstruct | MC9763
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 78 ± 6 aa |
| Standard deviation of domain lengths | 5.69 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 48.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A179INT5 | 57-133 | RRYDSWKDEEDRLLASLVLDYVRSGRTQLEAFVEAAGRLGRTASACGFRWNKALRTFYREELEAAKKERRERRKGRS |
| A0A437KFW1 | 15-100 | IKTNKGDKMPDTFTREQDALLAETVLRHIREGSTAIAAFEEVAVVMNKSAATCGYRWNNTVRHNYRGAFRLARKKRYELKYANNGS |
| A0A1V4HSB2 | 3-66 | None |
| A0A7C8GQZ5 | 3-78 | None |
| A0A2N0QHN7 | 3-80 | None |
| A0A2R6Y1E1 | 123-201 | None |
| W7YZ65 | 3-78 | None |
| A0A1G8QGE5 | 2-72 | None |
| A0A840QLF1 | 3-80 | None |
| A0A385U069 | 1-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.