DPCstruct | MC9762
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 104 ± 9 aa |
| Standard deviation of domain lengths | 8.80 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 67.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 46.28 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12638 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A803LQU0 | 88-183 | PLRYYIFCKELPVVLNAFVHGDENLFNNNPELQEATVWVYFHSSIPEFNKFECWGPLKCCFPPTSLIPWTPSLSHEQPQLDQELTGD… |
| A0A7J0FR96 | 39-145 | IFCKDLPVVIKAFVHGDGSLFDHFPELQESMVWVYFHSNTTEFNKVQCWGPVKNASAPPSSGSQQEEVPSSNWDLPKPCQENCTCCF… |
| A0A835N3E1 | 96-204 | None |
| A0A5N6NZB2 | 68-182 | None |
| A0A4S4EVU5 | 254-344 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.