DPCstruct | MC9761
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 52 ± 2 aa |
| Standard deviation of domain lengths | 1.87 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 93.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.98 |
| Mean intra-cluster local Distance Difference Test score | 0.98 |
| Mean intra-cluster sequence similarity (%) | 87.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00421 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453DVM0 | 1-51 | MWYGSATTPIELFGPTRYQWDQGYFQQEIYRRVSNGLAENLSLSEAWSKIP |
| A0A452YKI3 | 1-51 | MWYGSATTPIELFGPTRYQWDQRYFQQEIYRRVCNGLAKNLSLSEAWSKIP |
| A0A287U567 | 71-123 | None |
| J3MZ32 | 48-98 | None |
| A0A7J7L242 | 217-269 | None |
| A0A287F803 | 1-51 | None |
| A0A7I3Z1L7 | 26-76 | None |
| A0A830C908 | 27-76 | None |
| T1NHN7 | 86-138 | None |
| A0A0E0LJL4 | 148-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.