DPCstruct | MC976
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 479 ± 75 aa |
| Standard deviation of domain lengths | 75.33 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 66.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.28 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 18.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A146IB01 | 3-505 | YTADFEFHRSQFRAHILGTTSNPLPASFILPTGYWSSSEKDAFFHALQVHSRLRPDLIAADIKTKSVVDVCAYIDLLVHASAQSAPP… |
| A0A0W4ZG77 | 26-508 | TSNEKKMDGFLRLKGLFRRRSMFRMTVFRKRRLKTRCISEHINPVYLQLLNQTIKEIGEDRDVGIMRNILESSVINGDIWTSLEKER… |
| A0A0G2HUZ4 | 103-596 | None |
| W2RK03 | 1-545 | None |
| A0A2T6ZX73 | 177-697 | None |
| A0A4P9Y5N3 | 52-487 | None |
| A0A6A6AW83 | 2-482 | None |
| A0A0G4KNK9 | 89-564 | None |
| R4XFT3 | 43-409 | None |
| A0A0E9N852 | 255-871 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.