DPCstruct | MC9759
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 157 ± 15 aa |
| Standard deviation of domain lengths | 15.32 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 19.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z8QL90 | 2-134 | NFLGIIPEISGNISQWGDFGISVMFQGIFWDIVAEFDVSPYRTRQGEYCCSLCVDAYENGYAEEKPIYYSSRKELWIQHCYEPFLKW… |
| A0A7J5V8B1 | 1-177 | MKDRPIKHFYQQTLFLRWAARNRRLFSHQPYLLQQKKGSCDIAFRGVSKHITCCFTKPGAIMIGADYRNTNFDIIGEFDLYEERTPE… |
| A0A6J5A5R5 | 1-140 | None |
| A0A7C8FA98 | 199-373 | None |
| A0A7T8MBM7 | 29-180 | None |
| A0A8A7KK81 | 2-160 | None |
| A0A7T8MC03 | 1-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.