DPCstruct | MC9758
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 64 ± 9 aa |
| Standard deviation of domain lengths | 9.31 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 37.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y8IVZ0 | 1-58 | MKCFRCGGIMIHEKFYGLGDDFFGWRCIICGEILDPVIIENRLAQKQQNFMLRDRARR |
| A0A354C6N4 | 1-65 | MKCLRCGGLMIYEEFYNPQESFSGLKCLICGEAIDPIILENRKLISTIQRMSPRQVRRSKVVHHP |
| A0A0S4LCK3 | 54-105 | None |
| A0A533YAT3 | 1-70 | None |
| A0A533ZFV3 | 1-61 | None |
| A0A3M2D503 | 1-64 | None |
| A0A1F9D8L8 | 59-103 | None |
| A0A7X6DM09 | 1-51 | None |
| A0A7Y8LBE3 | 1-73 | None |
| A0A525W9S9 | 1-72 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.