DPCstruct | MC9755
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 146 ± 17 aa |
| Standard deviation of domain lengths | 16.63 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 28.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A356C7W8 | 7-155 | ENKEMSNGNRDMSRTILTDKEIEFVKSEIRRIGADESRFVFNDEAHIQSSTCYNFITDLIYVTRNVFPDTKYGSIHPRDIMSVGAVL… |
| A0A1I2D3A9 | 676-835 | EGADEGKNFIDTKGYRNDTPLTKEQINELISYAKKLNFPEYNIHIADSVNTTPTSIMYDTILTINNDVLPSKLPTKNPNSLISGRGT… |
| A0A3A4PHD6 | 8-141 | None |
| A0A8A7VZS6 | 2-113 | None |
| A0A6L5QWR5 | 9-152 | None |
| A0A3A6JJS4 | 112-302 | None |
| A0A410YFR2 | 20-176 | None |
| A0A2T3PUF7 | 1-153 | None |
| A0A0D6TK25 | 67-214 | None |
| A0A0C5UZF7 | 1067-1203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.