DPCstruct | MC9751
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 88 ± 8 aa |
| Standard deviation of domain lengths | 8.38 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 79.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 38.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0G1MHV3 | 1-107 | MKCFLPHFPSEKAVELMRWFGYAAHREDGFMSFVRSPFAPESRFPRFHASVYPIDGGLRVNIHLDQEDIADGQGNHQFVWAYRNPLV… |
| A0A1F5S477 | 1-89 | MRKLGYFENFDRHTGKTSYIKRISRESFYPRFHVYIAESDAGRVIDLHLDQKRPSYAGSHAHNAEYDSEPVKREAERMRGILAGMET… |
| A0A838MIK3 | 12-100 | None |
| A0A2G9ZMS2 | 1-99 | None |
| A0A1G1ZGB6 | 10-100 | None |
| A0A2H0L4P3 | 2-74 | None |
| A0A1F7VHW8 | 3-88 | None |
| A0A1G2RD68 | 30-116 | None |
| A0A1G2VEQ7 | 10-99 | None |
| A0A2M7XH21 | 2-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.