DPCstruct | MC9748
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 179 ± 14 aa |
| Standard deviation of domain lengths | 14.17 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 79.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 29.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C3BFJ6 | 381-565 | HLPDETYTSSNINDPTSTASSSNQTVDQPSLNQPLPDLQVHHLYRLQQCVPRHLKAYLDKCRPGDKRQLVLKTIAAMLSIDANKIDE… |
| A0A0C3A9Z5 | 1-189 | MTPAYEAVMQPLVETQDYSPPNPPVNEKDFLYSLIRLSLPIPLDTIVKSWAGEKWELVIDQLLQLLDHDVQTITQIGAGSWVPILSA… |
| A0A0C3B0C0 | 502-675 | None |
| A0A0C3BFK0 | 70-255 | None |
| A0A0C3BDM0 | 271-464 | None |
| A0A0C2XMN4 | 32-222 | None |
| A0A0C2XIC5 | 128-303 | None |
| A0A0C2WVN3 | 587-757 | None |
| A0A0C3AA01 | 25-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.