DPCstruct | MC9747
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 220 ± 31 aa |
| Standard deviation of domain lengths | 30.66 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 74.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 36.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C2XQW0 | 1-223 | MQTLTISEEPLAEAYSPEEVDDEHLPNWAKRTEFAEDPLGRAYALLVTFLPVELLHLLPSPSEPLTSTNLMLSLSSGQLLCIAYNAG… |
| A0A5C5G662 | 404-598 | RRRSGGGTAGGEGEGDDVAGEEEALPEWASETGWEDGLARAHAVTCAHAPAAQHPLPDPAVSRDAFLDALSDGTLLCHSFNSILRQS… |
| G0SV14 | 432-604 | None |
| A0A4Y9ZUW3 | 1-257 | None |
| A0A5B1QMV5 | 441-691 | None |
| J6F9C3 | 426-602 | None |
| A0A177VBG2 | 622-858 | None |
| A0A511K8F6 | 128-319 | None |
| A0A4S4N3Q1 | 316-559 | None |
| R7T0W6 | 439-685 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.