DPCstruct | MC9746
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 110 ± 14 aa |
| Standard deviation of domain lengths | 13.99 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 75.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 33.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E3NFA7 | 10-102 | SAFFDQFFAQQQRQQQQPQRSHEDEYLSKDCGKYLCPDTLACVSKPVDCPCPFPNSQQKCVFPPHPNNDHDDGSYICISKGSRDCKF… |
| A0A0C2XK53 | 3-120 | SLLWLVLAFTLLPSWAYAQFGFFDNMFQGQQGHGHHQQQQQHRAGSNQWAMQAESVSCNKYLCPGTLTCVDAPVNCPCPYPEDIKCV… |
| A0A167PEX6 | 128-231 | None |
| A0A1G4J8X8 | 5-98 | None |
| A0A179FJ27 | 63-173 | None |
| A0A1V2LHY6 | 3-97 | None |
| A0A1X2IKN2 | 1-116 | None |
| A0A4U0VU52 | 211-326 | None |
| G4TWM3 | 18-156 | None |
| A0A3N4LUZ5 | 10-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.