DPCstruct | MC9743
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 231 ± 19 aa |
| Standard deviation of domain lengths | 18.50 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 74.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 20.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1Q370 | 90-309 | MSYLGFKQQLTLKEFDQQFQLRFRELDHRHQQEVEEFRAKVSVAINQKNLDFQAWKFEQEVTLQNEMARFNRETQLIIVEEQRKTAL… |
| A0A2N6L2K7 | 5-223 | LKLLLQLVLEFAPVIATLVQKSNDARPDETKNDYPAQIQEIIQTVSSASEKLSYLGRYDEQQKPEEQQLAVYYHQTQLQIATQEQET… |
| A0A1L9QNA7 | 24-231 | None |
| A0A6M0FI99 | 46-298 | None |
| A0A350Y7H3 | 109-334 | None |
| A0A0P0FK79 | 1-204 | None |
| I4FRI3 | 19-266 | None |
| A0A2N9YBW2 | 73-305 | None |
| A0A1J5GG44 | 72-314 | None |
| A8YLJ6 | 4-264 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.