DPCstruct | MC9741
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 179 ± 19 aa |
| Standard deviation of domain lengths | 18.65 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 25.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A7ZT85 | 1-196 | MEQVQPDPAIFSHIRVVMGMVISLSLARLLSGVALFVQHPGKTKVYWIHLGWVLFMFVFLVHFWWWEYHLHSLAVIDVSVYLFVILY… |
| H0G8Q7 | 1-196 | MEQVQRDPAIFSHIRVVMGMVISLSLARLLSGVALFVQHPGKTKVYWIHLGWVLFMFVFLVHFWWWEYHLHSLAVIDVSVYLFVILY… |
| A0A3C2A7U6 | 4-178 | None |
| A0A2V5WR88 | 81-263 | None |
| F7X6T2 | 1-196 | None |
| A0A7C7NHE1 | 4-204 | None |
| A0A516P4Q8 | 1-137 | None |
| A0A552UHR0 | 4-184 | None |
| A0A6N4SMU6 | 3-174 | None |
| A0A525JB31 | 2-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.