DPCstruct | MC9740
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 377 ± 26 aa |
| Standard deviation of domain lengths | 25.91 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 80.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 24.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A543KAT1 | 16-377 | LRLIIFAVLLALPARAQVLTPEEMLAYVPPPFGLGEALNDKGLYRVVNSGGAPAGYAFTTPPYAALPGFAGAPINTLVVLNRAGTFV… |
| H0FVA6 | 18-415 | LVALCIAMLLAGSSMAAGQLSNYLQKVQPQEIFPGATRFGEVTGDPPIAPVFRGESLPGYAYLNSDVTSSVGYSGKPIHIVVGIDPK… |
| A0A2Z6DVT3 | 5-407 | None |
| A0A644U453 | 2-374 | None |
| A0A6G8CJN4 | 6-404 | None |
| A0A6L7XJF4 | 518-888 | None |
| A0A1T4U0U7 | 4-379 | None |
| A0A3M2E5P2 | 32-458 | None |
| A0A813ARI3 | 2-333 | None |
| A0A812IN96 | 326-675 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.