DPCstruct | MC974
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 119 ± 14 aa |
| Standard deviation of domain lengths | 13.89 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 35.03 |
| Pfam Score | 97.73 |
| Assigned Pfam label(s) | PF07286- CL0158 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S8SY05 | 6-99 | MEPKEVRRLIREGKITKTTSGMCAGYAQADLVILPKDFAYDFLLFTQRNPKSCPILEVSDVGSRSLNYIAEETDIAKDIPKHRVYKD… |
| H1SC78 | 9-121 | LMPFDFRQAVRSGQFRGPTAGYCGDHAQANLAILPSAHASDFLRFCQANPKPCPLLGVGEPGQWHVPVLGREVDIRNDVPAYNIYRD… |
| E4XTM2 | 90-215 | None |
| A0A2B7X838 | 6-116 | None |
| N4VMA5 | 5-138 | None |
| A0A7J6UMR5 | 49-186 | None |
| A0A6N9Y7W8 | 1-86 | None |
| A0A225B8V9 | 14-146 | None |
| A0A2K5UV09 | 305-425 | None |
| A0A672SF83 | 3-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.