DPCstruct | MC9738
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 117 ± 7 aa |
| Standard deviation of domain lengths | 7.32 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 77.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 45.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S3ARS2 | 277-388 | VGRRGGFVELAAAALLVAGAVIGSLVPLAAGWLAAWWSPRLSRTEAKWATLGMPGIVAAAGGVWLWGRMEGRWGERIAQGGDALGTA… |
| W9FS69 | 1-120 | MVAAPGPRGGFAHPLLLLAAVLLIAGVVTGSWLPLAGGWLLAYSSRTLSRTEAKWAALGLPGVVAAGALVWVWGRMEGRWGEPIREG… |
| A0A7K3H851 | 1-113 | None |
| A0A5C4USF6 | 90-192 | None |
| A0A2N0JRW4 | 153-273 | None |
| A0A3N1LCL5 | 232-351 | None |
| A0A553Z1E4 | 346-459 | None |
| A0A429TKB6 | 207-323 | None |
| A0A7L5SVZ0 | 285-413 | None |
| A0A285QKU3 | 203-330 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.