DPCstruct | MC9737
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 94 ± 4 aa |
| Standard deviation of domain lengths | 3.55 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 89.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 46.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J4NM96 | 27-120 | TDEDSFSSQHLKIQNDISKILTDFKFDAIICVAGGWAGGNASHKDFIKNTELMLKKSVWTSCIASTVAASFLAPGGLLVLTGAEPAL… |
| K1R783 | 49-142 | KPSESWLNQEDEVLKGVESIIGGEKLDAVLCVAGGWAGGNAASKEFIKNADMMWKQSVWTSSIAAALAAKYLKEGGIVTLPGAAPCV… |
| A0A261XWR2 | 490-588 | None |
| A0A085MFC1 | 49-136 | None |
| A0A3Q0IR85 | 1-94 | None |
| A0A556UG02 | 113-207 | None |
| A0A0C9LWR1 | 645-738 | None |
| A0A1I8JGJ5 | 51-146 | None |
| M2XB85 | 95-194 | None |
| A0A6L2Q7W8 | 48-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.