DPCstruct | MC9734
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 470 ± 103 aa |
| Standard deviation of domain lengths | 102.56 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 71.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 23.82 |
| Pfam Score | 81.94 |
| Assigned Pfam label(s) | PF14775- PF14772 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S3F3U7 | 17-377 | LETEIQTLEQQLEEMRATYQLNQEKLDYNYRVLVERDSENTNTIKTQKKKLTRMADMLSSLKQKYAREEKRFKEENADLTNEYKRIT… |
| A0A3Q3JAT6 | 82-525 | DVEESQQRTMLEEDQTKRLEQLVQDVNFFENKLEEITRKLSMAEEFTVEEVEEIERMEDQISALDMASIKLQAKIKLVDESSCQEKE… |
| A0A4C1TRW7 | 41-675 | None |
| A0A094ZE96 | 259-596 | None |
| A0A7J6YNC8 | 4-408 | None |
| A0A3P8FCA0 | 2-341 | None |
| A0A7R9GW98 | 57-562 | None |
| A0A5A8CHC8 | 102-809 | None |
| A0A0P4W235 | 143-620 | None |
| A0A437BZ89 | 18-564 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.