DPCstruct | MC9733
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 522 ± 45 aa |
| Standard deviation of domain lengths | 44.55 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 62.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02092- CL0040 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835RSR4 | 1-444 | MQCSNTEVGAGTMNPLTFLRVLGPEPWNVAYVEPSIRPDDSRYGDNPNRLQRHTQFQVILKPDPGNAQDLFINSLSALGIKVKAHDI… |
| V7APC7 | 1-564 | MGILALPLVISLLKPHATTRLRLSHSLLLRRPFATTVSATTTPHSPPPSSSPSLSRHSSASALSDNRSVNSSSLTFQQAIQRLQEYW… |
| A0A1D6NXM7 | 1-491 | None |
| A0A151SVV5 | 1-535 | None |
| A0A830HSS1 | 23-609 | None |
| A0A388QA21 | 2-491 | None |
| A0A453QA10 | 7-499 | None |
| A0A0R0KRN2 | 26-592 | None |
| A0A2P2LYB0 | 1-562 | None |
| A0A7W0J648 | 5-492 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.