DPCstruct | MC9732
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 117 ± 18 aa |
| Standard deviation of domain lengths | 18.17 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 30.05 |
| Pfam Score | 91.43 |
| Assigned Pfam label(s) | PF17407- PF17406 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P8S801 | 279-377 | VGFLRFLQLMATFDWKNNPLIVNLNGDIKDIDYAEIKNDFMAARSRLPVMFIATPKDRKDSFWTRDRPSALILQRLIMLSLESVNTL… |
| V7AGP1 | 10-139 | TPCYFWRLLSHYDWTFSPLVVDINSDLSQSDEKEINDNFLLRKSQGESGQSVWPAMFLATVYDKESEAWTGLSPSGMELKRLVAYAR… |
| A0A0N0PBL8 | 880-972 | None |
| A0A1I8G045 | 438-533 | None |
| A0A540K4Z8 | 1-159 | None |
| A0A2G3D7R1 | 237-365 | None |
| A0A2A2KRM4 | 268-386 | None |
| A0A5K3EKN7 | 484-632 | None |
| A0A1I8JB41 | 554-649 | None |
| A0A670Z235 | 691-785 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.