DPCstruct | MC9731
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 92 ± 12 aa |
| Standard deviation of domain lengths | 12.42 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 60.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S3QNP0 | 1-118 | MYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQVH… |
| V7ADX7 | 1-84 | MACDTFLKIVQKCKREFVITQVGENEPFVCEILNGLPNSIMDLEPHQIHSFHKSVHHMIEAESNVQKKNEYFQRLMELQNQVFR |
| A0A4S4DDY1 | 162-242 | None |
| A0A396GK11 | 2-97 | None |
| A0A3N7FA05 | 2-90 | None |
| A0A836DAZ6 | 329-412 | None |
| A0A843W9J8 | 6-88 | None |
| A0A183EAX3 | 1-83 | None |
| A0A287T288 | 1-91 | None |
| A0A6A2Z5T4 | 10-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.