DPCstruct | MC9730
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 108 ± 8 aa |
| Standard deviation of domain lengths | 8.48 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 73.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.58 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 46.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11321 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0E0AKI6 | 38-136 | FKKGDEVRVRTPLGRLGTTTLRLVMWLGAVVVSDADDGHLEVIYNGNFPRDDPFRTVRVAVKDVKLPAPRPAPTPANMAAPRPNKAG… |
| A0A811S543 | 1-119 | MKPGTVVRVRTRTATLKTGQVLVLCLKATIVSSSTDGGYEVVYDANWPRGDPKSAVYVAPHQGRLINPSPSPMTPPQSLPPPTATVA… |
| A0A0E0Q8W3 | 48-145 | None |
| Q84NU6 | 114-213 | None |
| A0A0Q3TSG9 | 1-109 | None |
| A0A0E0I1B8 | 180-277 | None |
| I1PDL0 | 56-162 | None |
| A0A835BQR1 | 47-158 | None |
| A0A0E0KZQ9 | 64-186 | None |
| Q75LE8 | 1-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.