DPCstruct | MC973
Metacluster Properties and Pfam Annotations
| Number of structural domains | 91 |
|---|---|
| Mean domain length (aa) | 354 ± 69 aa |
| Standard deviation of domain lengths | 69.46 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 85.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 24.20 |
| Pfam Score | 97.78 |
| Assigned Pfam label(s) | CL0062- PF19278- PF06032- CL0108 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X5DC53 | 2-290 | LNRVVQRRGMEVGLICNKGFEQMHSMGRALQSYLGYALEERLHINTHKYDDPLIPLKRIRGVTERTDVKGQVVIPVRQEEVKVAVKE… |
| H1SB19 | 17-386 | RWQFWIDRGGTFTDVVGFQPDGTIVTHKLLSENPEQYNDAAVAGIRHLLGLAPGEPVTPAQVEVVKMGTTVATNALLERKGEPVALF… |
| H0EM88 | 2-438 | None |
| F3NJY9 | 5-287 | None |
| A0A1I5VRE7 | 2-276 | None |
| A1ZD09 | 71-406 | None |
| A0A6A6Z204 | 38-291 | None |
| A0A6J7HYF7 | 1-231 | None |
| A0A6M0F5R8 | 9-265 | None |
| A0A5C4M151 | 2-307 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.