DPCstruct | MC9729
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 383 ± 31 aa |
| Standard deviation of domain lengths | 30.71 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 74.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 43.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0359 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D6LQG9 | 335-740 | LGIEFQAVPPSVLHPPMSEKAKRARKKYLKMKAEKAQELKNARETRRKKLGLKILNHLSKRMRRGEEFEFDFRIEKEVQQVFRDWAE… |
| A0A811S0Y5 | 5-345 | EEFEFDFRIEKEVQQLFRDWAEETVAEYFESREHCQYWHRLLASGDFLSLNRVRDQLPPALVDSYDKLQETIDKFFMPMGGHDMTEQ… |
| V4LD34 | 363-766 | None |
| A0A151SNX9 | 214-592 | None |
| A0A314YSA9 | 2-406 | None |
| A0A2U1QLK2 | 151-520 | None |
| A0A0A9PZ07 | 1-303 | None |
| A0A7N2R7B1 | 240-644 | None |
| A0A0E0FP19 | 50-453 | None |
| A0A5J9TA94 | 834-1223 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.