DPCstruct | MC9728
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 80 ± 4 aa |
| Standard deviation of domain lengths | 4.31 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 93.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 50.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0369 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453HQN7 | 86-166 | DFHVYTDSKTLFNMKGTFDKTSRTGPKAFVSEYAVWRTDAGRGSLLGSLAEAAFLTGLEKNSDIVQMASYAPLFVNDNDQT |
| A0A2K3ME31 | 118-196 | DIYDYHIYTNSKDMFSKYTKFDNSPRSGPKAFVSEYVVWKEDAGAGSLYAAMAEAAFLIGIEKNSDAVSMVAYAPLLFK |
| A0A815L7N1 | 65-149 | None |
| W1I8V6 | 307-384 | None |
| A0A0A9PQF7 | 1-71 | None |
| A0A446SXE9 | 178-260 | None |
| A0A446R258 | 63-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.