DPCstruct | MC9726
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 352 ± 47 aa |
| Standard deviation of domain lengths | 47.39 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 19.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812IN01 | 602-922 | GKFEPSLAPAFVATQKKMGAQSLRKQKKDYGPIVSKDEHGRKCFDEMLHNEKEFCGEWVVFYHSYSSAALLYEVQAAVASVLFRFKA… |
| A0A2D6RSR5 | 236-575 | AQFALRNLETPVSSSVETSLAQALPSETQALIEHAEAPTRVWLSQHPNQLPPGWDQDTIDKLPVSIPEIIRIEDEHSKSHVVAYHAF… |
| A0A3D4XWT8 | 28-346 | None |
| A0A6P0R2N3 | 229-527 | None |
| A0A7S2SU15 | 331-652 | None |
| A0A812KJK4 | 379-713 | None |
| A0A812WQJ1 | 105-484 | None |
| A0A4Q7DHU1 | 11-336 | None |
| A0A4Q7DIE5 | 428-837 | None |
| A0A1G0H6B6 | 27-384 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.