DPCstruct | MC9725
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 160 ± 26 aa |
| Standard deviation of domain lengths | 26.05 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 90.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 28.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V8LNA4 | 17-178 | RAHWEAAADHLLDAVVPYAVPGAAQYRLPGRPSTAGLSSDGLEGFARTFLLAAFRIAGAGGAVPAALIERYAQGLAHGTDPAHRYAW… |
| A0A826HTQ7 | 8-147 | SLKSNLFLTREAYLEAFETIMTPLKTAILTSEKPGVNFGSSGAVYDQQHAEMEALIRPLWGIGPYWVACKDDVLRDAYVEKLIAGTD… |
| A0A1V6S369 | 433-580 | None |
| A0A7W4Z9X4 | 21-205 | None |
| A0A7K1TQ05 | 529-735 | None |
| A0A485C0U1 | 1-139 | None |
| A0A370TB92 | 529-716 | None |
| A0A842Z715 | 9-183 | None |
| G6YRK3 | 51-204 | None |
| A0A1B7YGG6 | 17-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.