DPCstruct | MC9724
Metacluster Properties and Pfam Annotations
| Number of structural domains | 85 |
|---|---|
| Mean domain length (aa) | 132 ± 22 aa |
| Standard deviation of domain lengths | 21.82 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 83.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 21.16 |
| Pfam Score | 95.56 |
| Assigned Pfam label(s) | PF09724- PF00074 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A669CJM3 | 4-99 | DSFPPTECTQVMRRRGIKGQNGGCKEINTFLLDTGVRVRNTCAGHHGIRSVGFNVVVCSHVHTSSYPNCRYTGQHLDNRIVDIMCEN… |
| G3VEI7 | 11-141 | LLTFLVLPNFSHTKDFWTLHVDYPKTKVSGNPSQYCNVMMKQRGLINDSYHLPIHTFIHETNKTILNICANSSESSQSSTGQNSYES… |
| A0A669B086 | 8-132 | None |
| A0A3B5PSE5 | 17-132 | None |
| G3I1R6 | 199-333 | None |
| I3N829 | 23-183 | None |
| A0A6P8GBD5 | 25-185 | None |
| W0UV54 | 15-157 | None |
| A0A3B4UTB5 | 10-118 | None |
| A0A402FI27 | 173-320 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.