DPCstruct | MC9722
Metacluster Properties and Pfam Annotations
| Number of structural domains | 72 |
|---|---|
| Mean domain length (aa) | 102 ± 11 aa |
| Standard deviation of domain lengths | 10.94 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 18.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y9Z8W5 | 3-124 | GDGTTLTAVSVLDEPGLYSLTSLGPTTYYVDSTNPATPRYMRWRGAGISLSSPMDNRWHDLIMLGASPDDDPDDADAWEWTLKVGCY… |
| A0A2V8NRA5 | 1-90 | MQLETMQDMDRLIVRTDNSTYEITLISARSGEILIRGGRFFPEFTPVRLAGSSLGGSFLKLRGIYLGFNLEIQVDRQLIVTSRVRKI… |
| A0A5C7Y309 | 193-288 | None |
| A0A5C7YKZ1 | 276-354 | None |
| A0A5C7Y202 | 27-123 | None |
| A0A2W1TKL0 | 4-105 | None |
| A0A413RPE9 | 89-192 | None |
| A0A3D2ICC6 | 9-99 | None |
| A0A2V7WUP9 | 5-111 | None |
| A0A837DX68 | 99-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.