DPCstruct | MC972
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 80 ± 11 aa |
| Standard deviation of domain lengths | 11.31 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 41.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J3NC57 | 67-134 | AIYTAGMAARARSPGTGATDVFVHDVDRPVEDSFSKAFLCEGYLAEQVGRIRRFVIPSHREKDGTPFC |
| A0A0E0BJ54 | 74-147 | GAIYTAAALARASAAGGREAVDVAVHDVHRTVERWYAWEYLCEDNLAAAKGRLWHFRVAGGGPPDAFCPTGPAQ |
| B8BKJ3 | 186-290 | None |
| A0A6A2XAJ8 | 187-264 | None |
| A0A835E3X3 | 195-299 | None |
| A0A6A6L4J2 | 135-211 | None |
| A0A2G3AZL7 | 626-697 | None |
| A0A0E0JVT0 | 483-557 | None |
| A0A6A2YS68 | 65-168 | None |
| A0A3S3P3T3 | 17-85 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.