DPCstruct | MC9719
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 92 ± 20 aa |
| Standard deviation of domain lengths | 20.30 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 93.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 38.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M8U074 | 112-214 | RDPDPALVRKLVDAARGHARMVTLAPELPGGLDSVRMLADLGVIAAVGHTDSDYTRTLEAIGAGATVATHLFNAMPGIAHRAPGPIV… |
| A0A1H6CKN6 | 25-93 | LIKMVTIAPELPGGMELLRFLKEQEVVIAVAHSDATYEEAKAAFTAGASHVTYCFNGMRPIHHRDPGLV |
| A0A2A2KT93 | 171-259 | None |
| A0A6I5VR31 | 111-207 | None |
| A0A1V5UYD9 | 95-222 | None |
| A0A139PKN1 | 2-80 | None |
| A0A1Q5THC6 | 3-73 | None |
| A0A2M7R5H7 | 44-137 | None |
| A0A7H4MFS2 | 2-84 | None |
| A0A7R8L5N3 | 136-260 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.