DPCstruct | MC9718
Metacluster Properties and Pfam Annotations
| Number of structural domains | 210 |
|---|---|
| Mean domain length (aa) | 289 ± 66 aa |
| Standard deviation of domain lengths | 66.14 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 87.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 22.07 |
| Pfam Score | 81.17 |
| Assigned Pfam label(s) | CL0233- CL0486- CL0635- PF01315- CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W2A954 | 8-294 | RAMGTDRARHDAVAKVTGTAPYAADHEQAERVHLHPVQATIARGRIASIDTSAAEALDGVILTLTHLDAPRLASSDDTEMLILQSDE… |
| A0A3P4MUE2 | 329-696 | LEDFPIKTPQGTQMFQCVDPYQSPQDPVGHPVMHQSAIKHATGEAVFSDDMPPFAQELFLAVKTSTRAHAKIISIDASEALALPGVV… |
| A0A1D2N811 | 152-516 | None |
| A0A377C3W8 | 5-291 | None |
| A0A212DU10 | 2-248 | None |
| A0A3Q0JHS8 | 206-533 | None |
| A0A168LZP3 | 141-458 | None |
| A0A3Q0ILS3 | 515-773 | None |
| A0A812ZMB1 | 621-941 | None |
| A0A836RE28 | 6-247 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.