DPCstruct | MC9712
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 110 ± 14 aa |
| Standard deviation of domain lengths | 13.77 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 45.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05360 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S7ED57 | 17-119 | AALLLGSTAYLIGLWNAQMMLNEKGCYFTLLLFGLFASVSLQKSVRDRADGIPVTGLFYAIGWFSLIIALLLLAIGLINATLLLSEK… |
| A0A090IP89 | 23-131 | GTTAYLFGLWYSNMELNEKGYYLSLLLLGLFAAISLQKTIRDKQEGMNITVMYTMCCRVALIAAIALLAVGLRNAELLLSEKGFFTM… |
| U4TDF5 | 1-104 | None |
| A0A4R3VBX6 | 41-181 | None |
| A0A0E1M2V8 | 7-113 | None |
| A0A8B4QTI0 | 49-159 | None |
| A0A377ZYA0 | 1-101 | None |
| A0A7W7H2B9 | 31-135 | None |
| A0A7Y0LH45 | 15-127 | None |
| A0A5C7W1G9 | 2-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.