DPCstruct | MC9711
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 316 ± 41 aa |
| Standard deviation of domain lengths | 40.93 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 25.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0110 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A090I8K3 | 1-335 | MSIEDKIKLSNNIYYFFMGKIKNGFTYNEAAVNACQYFFDETIKNTSIIPNSDLGIEFMDINDLPLDNEIKKFYYYELILRANLASC… |
| A0A489FJU5 | 1-312 | MEIIYDKQKNFINYYKTQREENPDLIIDDIVKIYLSNEYSKDIDELNSYIEESLNKVTENSGNDVRNFEEFKGGESFKLYEQELVER… |
| A0A6L2ZRZ3 | 168-454 | None |
| A0A2U8I7B5 | 276-637 | None |
| O68653 | 175-517 | None |
| Q9EXR0 | 180-519 | None |
| A0A376U9H5 | 10-261 | None |
| A0A2U8I5V6 | 171-511 | None |
| A0A828U171 | 431-661 | None |
| A0A2X3JAL5 | 41-327 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.